Atom Biology General Molecule Reaction Tools Trial Virus

1 2 3 > >>   ∑:57  Sort:Date

OBF (Open Bioinformatics Foundation) Tools
Where to find molecule FAQ (Frequently Asked Questions)? I want to learn more about OBF (Open Bioinformatics Foundation) and its software tools. Here is a large collection of tutorials to answer many frequently asked questions compiled by FYIcenter.com team about OBF (Open Bioinformatics Foundation)... 2023-02-04, 3909🔥, 0💬

"mvn dependency:build-classpath" - Generate Class Pass
How to generate class path for dependences with Maven? If you run your application JAR file generated from Maven, you need to include JAR files of all dependences in the class path. One way to build this class path is to use the "mvn dependency:build-classpath" command. 1. Generate class path of all... 2023-04-17, 2439🔥, 0💬

Pairwise Sequence Alignment Score Settings
How to change Pairwise Sequence Alignment Score Settings? Bio.Align.PairwiseAligner().al ign()uses a set of Alignment Score Settings to control how each possible alignment score is calculated. It then returns only those alignments that have the highest score. Here are the Alignment Score Settings th... 2023-05-09, 1546🔥, 0💬

Scan Prosite Database with Bio.ExPASy.ScanProsite.scan()
How to Scan Prosite Database with Bio.ExPASy.ScanProsite.scan() function? Bio.ExPASy.ScanProsite.scan() function allows to scan the Prosite database with a given sequence. Here is an example on how to Scan Prosite Database. fyicenter$ python >>> from Bio.ExPASy import ScanProsit... 2023-09-05, 1492🔥, 0💬

Play with the ls_orchid.fasta File
How to download and process ls_orchid.fasta file? ls_orchid.fasta file is an example of DNA sequence file in FASTA format provided in the Biopython source code package. You can also download it and use it to test Biopython library. 1. Download ls_orchid.fasta. fyicenter$ curl https://raw.githubuserc... 2023-07-08, 1269🔥, 0💬

Install BioPerl Package with "cpanm"
How to install BioPerl package with "cpanm" command? Using "cpanm" command is the best option to install the BioPerl distribution package automatically as shown in this tutorial on a CentOS computer: 1. Make sure that you have "cpanm" command installed. If not run the command below: fyicenter$ sudo ... 2023-02-28, 1255🔥, 0💬

Search for Related Items in NCBI with Bio.Entrez.elink()
How to Search for Related Items in NCBI with Bio.Entrez.elink() function? Bio.Entrez.elink() function allows you to find related items in a NCBI database for a given record. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. Here is an example on how to find related items with the Bio... 2023-08-25, 1216🔥, 0💬

Read Motif in JASPAR Format with Bio.motifs
How to Read Motif in JASPAR Format with Bio.motifs Module? The Bio.motifs.read() function allows to read motif files in several formats including JASPAR. 1. Download motif file in JASPER format by going to https://jaspar.genereg.net/mat rix/MA0080.5/and clicking the "JASPAR" download button. You see... 2023-07-05, 1141🔥, 0💬

Biopython for Sequence Motif Analysis
Where to find FAQ (Frequently Asked Questions) on Biopython for Sequence Motif Analysis? Here is a list of tutorials to answer many frequently asked questions compiled by FYIcenter.com team on Biopython for Sequence Motif Analysis. What Is Sequence Motif Analysis Create Motif With Biopython Bio.moti... 2023-07-29, 1125🔥, 0💬

Calculate Pairwise Sequence Alignment
How to Calculate Pairwise Sequence Alignment? You can use the Bio.Align.PairwiseAligner() function to Calculate Pairwise Sequence Alignment. It uses the Needleman-Wunsch, Smith-Waterman, Gotoh (three-state), and Waterman-Smith-Beyer global and local pairwise alignment algorithms. Here is an example ... 2023-05-09, 1124🔥, 0💬

BioPerl Modules Installation Options
What are installation options for BioPerl modules? There are several ways to install one or more BioPerl modules. 1. Using "cpanm" command - Run "cpanm ..." to install the given module automatically from cpan.org repository, if have "cpanm" installed. For example, run "cpanm Bio::SeqIO" to install B... 2023-03-07, 1112🔥, 0💬

What Is BioPerl
What is BioPerl? BioPerl is a toolkit of perl modules useful in building bioinformatics solutions in Perl. It is built in an object-oriented manner so that many modules depend on each other to achieve a task. The collection of modules in the bioperl-live repository consist of the core of the functio... 2023-04-05, 1099🔥, 0💬

Install BioPerl Package Manually
How to install BioPerl package manually? I am having trouble using the "cpan/cpanm" command. If you are having problems using the "cpan/cpanm" command, you can following this tutorial to install the BioPerl 1.7.7 distribution package manually. 1. Go to metacpan.org/pod/BioPerl . 2. Click "Download (... 2024-02-05, 1094🔥, 2💬

Motif PCM, PFM, PPM, PWM with Bio.motifs
How to Calculate Motif PCM, PFM, PPM, and PWM with Bio.motifs Module? There are several statistical matrices associated with a sequence motif sample set. PCM (Position Count Matrix) - PCM contains Counts of occurrences of each letter at each position. We can get PCM with "counts" property of a motif... 2023-07-01, 1074🔥, 0💬

BioJava Library Installation Options
What are installation options for BioJava Library? There are several ways to install BioJava Library. 1. Using "Maven" build tool - Add BioJava as a dependency to your project pom.xml file: <dependencies> <dependency> <groupId>org.bio java</groupId&... 2023-04-25, 1063🔥, 0💬

Install Biopython
How to install Biopython? The easiest way to install Biopython is to use the "pip" command as shown below. 1. Make sure that Python 3 is installed. fyicenter$ python --version Python 3.8.8 2. Install Biopython. fyicenter$ pip install biopython Requirement already satisfied: numpy in ... Installing c... 2023-02-04, 1014🔥, 0💬

What Is BioJava
What is BioJava? BioJava is a open-source Java library for bioinformatics. BioJava versions and release dates are: BioJava 6.1.0 BioJava 6.0.0 BioJava 5.3.0 BioJava 5.2.0 BioJava 5.0.0 BioJava 4.2.9 BioJava 4.2.1 BioJava 4.2.0 BioJava legacy 1.9.1 Main modules of BioJava: The Core Module (biojava-co... 2023-04-26, 1012🔥, 0💬

Fetch Sequences from NCBI with Bio.Entrez.efetch()
How to Fetch Sequences from NCBI with the Bio.Entrez.efetch() function? Bio.Entrez.efetch() function allows you to fetch DNA or protein sequences from NCBI databases: PubMed, GenBank, GEO, and many others. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. Here is an example on how to... 2023-08-25, 1011🔥, 0💬

Fetch Sequences from SwissProt with Bio.ExPASy.get_sprot_raw()
How to Fetch Sequences from SwissProt with Bio.ExPASy.get_sprot_raw() function? SwissProt with Bio.ExPASy.get_sprot_raw() function allows you to fetch protein sequences from SwissProt database. Here is an example on how to Fetch Sequences from SwissProt. fyicenter$ python >>> fr... 2023-09-10, 998🔥, 0💬

mRNA, Protein and Translation
How to derive protein sequence from a mRNA sequence? Biologically, the protein sequence is produced by a translation process from a mRNA sequence. We can simulate this biological translation process using the translation() function. fyicenter$ python >>> from Bio.Seq import Seq ... 2023-03-17, 997🔥, 0💬

Read Sequence Alignments with Bio.AlignIO
How to Read Sequence Alignments with Bio.AlignIO package? Bio.AlignIO module allows you to read and write Sequence Alignments as MultipleSeqAlignment objects. Enter the following sequence alignment file, PF05371_seed.faa, in FASTA format. >COATB_BPIKE/30-81 AEPNAATNYATEAMDSLKTQAIDLISQTWP VVTTV... 2023-09-05, 975🔥, 0💬

What Are Translation Tables
What Are Translation Tables? Translation tables, also called codon tables, are conversion tables that map 3-nucleobase combinations into amino acids to form protein sequences. It is known that all organisms do not use exactly the same translation table. But they vary from a standard translation tabl... 2023-03-17, 974🔥, 0💬

Pre-defined Sequence Alignment Score Settings
How to Use Pre-defined Sequence Alignment Score Settings? Biopython provides 3 Pre-defined Sequence Alignment Score Settings: "blastn" and "megablast" for nucleotide alignments, and "blastp" for protein alignments. Here is an example on how to "blastp" score settings. fyicenter$ python >&... 2023-08-03, 969🔥, 0💬

Retrieve Record Summary with Bio.Entrez.esummary()
How to Retrieve Record Summary with Bio.Entrez.esummary() function? Bio.Entrez.esummary() function allows you to retrieve summary information of a given record in a given NCBI Databas. It uses the Entrez Web services provided by www.ncbi.nlm.nih.gov. 1. Retrieve summary information from the "nlmcata... 2023-08-09, 968🔥, 0💬

1 2 3 > >>   ∑:57  Sort:Date

Atom Biology General Molecule Reaction Tools Trial Virus